PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G248800.1.p
Common NameGLYMA_05G248800, LOC100796042
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 714aa    MW: 79304.9 Da    PI: 6.8128
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G248800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.14.1e-202176156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         r++ +++t++q+++Le++F+++++p++++r +L+++lgL  rq+k+WFqNrR+++k
  Glyma.05G248800.1.p 21 RKRYHRHTANQIQRLESMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQNRRTQMK 76
                         789999***********************************************998 PP

2START170.89.2e-542244482206
                          HHHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   2 laeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv...dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          +a  a++e++++++ +ep+W ks        +s+ +d   +k+ +       ++ea+r+sgvv  ++  lv  ++d + +W + ++    
  Glyma.05G248800.1.p 224 IASNAMEEFLRLVQTNEPLWLKSNvdrrdvlSSDAYDRMFSKPNTRSKnpnVRIEASRDSGVVLLNSLALVDMFMDPN-KWIQLFPtivs 312
                          67899*******************9999777777777777777554338999**************************.99999999999 PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                           a t++vissg      g lqlm++elq+lsplv+ R+f+f+Ry++q ++g+w+++dvS d +q+    ++  R+++ pSg+li+++++g
  Glyma.05G248800.1.p 313 VARTIQVISSGvmgscsGSLQLMYQELQVLSPLVStREFYFLRYCQQIEQGTWAVMDVSYDFPQDSH-FAPQFRSHRCPSGCLIQDMPDG 401
                          *****************************************************************99.8********************* PP

                          EEEEEEEE-EE--SS.XXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgr.lphwllrslvksglaegaktwvatlqrqcek 206
                          hsk+tw+ehv+ +++ lph l+r l+ sg+a+ga +w+ tlqr ce+
  Glyma.05G248800.1.p 402 HSKITWIEHVEIEDKtLPHRLYRNLIYSGMAFGAERWLTTLQRMCER 448
                          ************876267***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.18E-20678IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-22680IPR009057Homeodomain-like
PROSITE profilePS5007118.0911878IPR001356Homeobox domain
SMARTSM003891.2E-181982IPR001356Homeobox domain
CDDcd000867.35E-192079No hitNo description
PfamPF000469.4E-182176IPR001356Homeobox domain
PROSITE patternPS0002705376IPR017970Homeobox, conserved site
PROSITE profilePS5084851.165214451IPR002913START domain
SuperFamilySSF559614.81E-36215449No hitNo description
CDDcd088755.27E-113218447No hitNo description
SMARTSM002342.1E-45223448IPR002913START domain
Gene3DG3DSA:3.30.530.208.8E-10224431IPR023393START-like domain
PfamPF018525.7E-46224448IPR002913START domain
SuperFamilySSF559617.46E-24469706No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MEYGGSQSPG EQDGSDSQER RKRYHRHTAN QIQRLESMFK ECPHPDEKQR LQLSRELGLA  60
PRQIKFWFQN RRTQMKAQHE RADNCALRAD NDKIRCENIA IREALKNVIC PSCGGPPLND  120
DSYFNDHKLR LENAHLKEEL DRVSSIAAKY IGRPISQLPP VQPIHISSLD LSMASFGNQG  180
MVGPAPAPSL NLDLLPAGTS SSMPNLPYQP PCLSDMDKSL MSDIASNAME EFLRLVQTNE  240
PLWLKSNVDR RDVLSSDAYD RMFSKPNTRS KNPNVRIEAS RDSGVVLLNS LALVDMFMDP  300
NKWIQLFPTI VSVARTIQVI SSGVMGSCSG SLQLMYQELQ VLSPLVSTRE FYFLRYCQQI  360
EQGTWAVMDV SYDFPQDSHF APQFRSHRCP SGCLIQDMPD GHSKITWIEH VEIEDKTLPH  420
RLYRNLIYSG MAFGAERWLT TLQRMCERFT YLMATSNPTR DNLGGVISSP EGKRSMMKLA  480
QRMVTDFCAS ISTSSGHRWT TLSGLNEIVV RVTVHKSSDP GQPNGVVLSA ATTIWLPTPP  540
HTVFNFFKDE NKRPQWDVLS NGNAVQEVAN IANGLHPGNC ISVLRAFNNS QNMLILQESC  600
IDSYGSLVVY CPVDLPSINT AVSGEDPSYI PLLPNGFTIL PDGQPDQEGD GASTSSNTNR  660
NIARSGGSLV TIAFQILVSS LPSAKVNMES VTTVNNLIGS TVQQIKSSLS CPT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-126AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003524332.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA0A0B2PN290.0A0A0B2PN29_GLYSO; Homeobox-leucine zipper protein HDG11
TrEMBLI1K5830.0I1K583_SOYBN; Uncharacterized protein
STRINGGLYMA05G33520.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF10263398
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11